Transcript | Ll_transcript_56851 |
---|---|
CDS coordinates | 1-405 (+) |
Peptide sequence | VTLPVPIPPVTVPPVTYPPVTVPPVLNPPTTPGKGGNKPCPPPKSPAQATCSIDTLKLGACVDLLGGLVHIGVGDPAVNECCPVLQGLVEVEAAACLCTTLKLKLLNLNIYVPIALQLLVTCGKSPPPGYTCSL* |
ORF Type | 5prime_partial |
Blastp | 36.4 kDa proline-rich protein from Lycopersicon with 64.37% of identity |
---|---|
Blastx | pEARLI1-like lipid transfer protein 1 from Arabidopsis with 44.71% of identity |
Eggnog | - |
Kegg | - |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019452742.1) |
Pfam | Hydrophobic seed protein (PF14547.5) |
Rfam | - |
GO | - |
Grab and slide to change sequence position
Alignmet by MSA Viewer