Protein coding transcript 238601

• Transcript: Ll_transcript_56131
• CDS coordinates: 694-1014 (+)
• Peptide sequence: MDAYSAAAVKVGPCSFSGSRVANYGGQVILPLAHTVEHEEFLEVIKLEGIAHSPEEAMMPREVFLLQLCSGMDENAVGTCAELIFAPIDASFADDAPLLPSGFRIIP
• ORF Type: 3prime_partial

Annotations of Ll_transcript_56131

• Blastp: Homeobox-leucine zipper protein ATHB-15 from Arabidopsis with 83.18% of identity
• Blastx: Homeobox-leucine zipper protein ATHB-15 from Arabidopsis with 86.05% of identity
• Eggnog: homeobox-leucine zipper protein(ENOG410XQ3R)
• Kegg: Link to kegg annotations (AT1G52150)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019429328.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;