Protein coding transcript 238608

• Transcript: Ll_transcript_56119
• CDS coordinates: 694-1038 (+)
• Peptide sequence: MDAYSAAAVKVGPCSFSGSRVANYGGQVILPLAHTVEHEEFLEVIKLEGIAHSPEEAMMPREVFLLQFIGCCFGSYVVEWMRMLSAPVPSLYLLQLMRPLLMMPLFYLLDFASFL
• ORF Type: 3prime_partial

Annotations of Ll_transcript_56119

• Blastp: Homeobox-leucine zipper protein ATHB-15 from Arabidopsis with 72.06% of identity
• Blastx: Homeobox-leucine zipper protein ATHB-15 from Arabidopsis with 78.89% of identity
• Eggnog: homeobox-leucine zipper protein(ENOG410XQ3R)
• Kegg: Link to kegg annotations (AT1G52150)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019429328.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;