Transcript | Ll_transcript_56112 |
---|---|
CDS coordinates | 331-783 (+) |
Peptide sequence | MLLIMFFLFLCRFSSGDTNLVLREFEKCGEILKHVPGPRDANWMHILYQNRSDAQKALHKNGMQINGVLIVGVKPLDPMQRKALNERQNNQEFMPLPLSSARLSETSTLRASSRPYYLQNGNSGVRQTGATIASPTKSLVSKVMDLMFGV* |
ORF Type | complete |
Blastp | Nuclear pore complex protein NUP35 from Arabidopsis with 67.59% of identity |
---|---|
Blastx | Nuclear pore complex protein NUP35 from Arabidopsis with 70.5% of identity |
Eggnog | nucleoporin(ENOG4111ARE) |
Kegg | Link to kegg annotations (AT3G16310) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019448175.1) |
Pfam | Nup53/35/40-type RNA recognition motif (PF05172.12) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer