Protein coding transcript 238616

• Transcript: Ll_transcript_56117
• CDS coordinates: 372-953 (+)
• Peptide sequence: MSTTVQKTPRSGRQSLFFKDLASPVSTRRGKFSSPGQAAPVSTPWRENFGGSDLPPPPFYTLEDRSDFSPESGIPDYQVSPETKSDPRSPMQSSNTEFSTPLKNKSEASTSYALRGVQQNHQDSPGLNWWSPVPAKSGSEQDDKATSSPVEGVIQPGALITLPPPLEVARPEVKRNSFPAGNLIEEEWVTVYG*
• ORF Type: complete

Annotations of Ll_transcript_56117

• Blastp: Nuclear pore complex protein NUP35 from Arabidopsis with 68.39% of identity
• Blastx: Nuclear pore complex protein NUP35 from Arabidopsis with 68.39% of identity
• Eggnog: nucleoporin(ENOG4111ARE)
• Kegg: Link to kegg annotations (AT3G16310)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019458803.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;