Transcript | Ll_transcript_56132 |
---|---|
CDS coordinates | 412-1065 (+) |
Peptide sequence | MMAVSSGCKEGSKVIMDNGKYVRYTPEQVEALERLYHECPKPTSLRRQQLIRECPILSHIEPKQIKVWFQNRRCREKQRKEASRLQAVNRKLTAMNKLLMEENDRLQKQVSQLVYENSFFRQHTTQNQATLATADTSSESVVTSGQRHLTPRHPPRDASPAGLLSIAEETLADFLSKATGTAVEWVQMPGMKPGPDSIGIVAISHGCPGVAARACGLV |
ORF Type | 3prime_partial |
Blastp | Homeobox-leucine zipper protein ATHB-8 from Arabidopsis with 89.16% of identity |
---|---|
Blastx | Homeobox-leucine zipper protein ATHB-8 from Arabidopsis with 89.16% of identity |
Eggnog | homeobox-leucine zipper protein(ENOG410XQ3R) |
Kegg | Link to kegg annotations (AT4G32880) |
CantataDB | - |
Mirbase | cln-MIR166 (MI0022568) |
Ncbi protein | Link to NCBI protein (XP_019417530.1) |
Pfam | Homeobox domain (PF00046.28) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer