Transcript | Ll_transcript_58014 |
---|---|
CDS coordinates | 2389-3117 (+) |
Peptide sequence | MRKFVMEAGWVPKKLDVYIDVPDIIDISHMRSKGHQPGEELLPDGVPEEDSDKPWVNEEIVSQLVSMGFNHIHCEKAVINTSNAGVEEAMNWLLSHMDDPDIDAPISKGQGSESVDQSKVDTLISFGFQEDVARKALKASNGDIEKATDWIFSNPDATVSSMDATSSNNASVPNGDDLPDGGGKYRLIGIVSHIGTSTQCGHYVAHILKDGRWVIFNDNKVGVSINPPKDMGYLYFFERLSE* |
ORF Type | complete |
Blastp | Ubiquitin carboxyl-terminal hydrolase 14 from Arabidopsis with 77.69% of identity |
---|---|
Blastx | Ubiquitin carboxyl-terminal hydrolase 14 from Arabidopsis with 75.26% of identity |
Eggnog | ubiquitin carboxyl-terminal hydrolase(COG5207) |
Kegg | Link to kegg annotations (AT3G20630) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019442655.1) |
Pfam | Ubiquitin carboxyl-terminal hydrolase (PF00443.28) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer