Protein coding transcript 238625

• Transcript: Ll_transcript_58017
• CDS coordinates: 154-957 (+)
• Peptide sequence: MMELDPMDLLRSNLSRVRIPEPTNRIYKQECCLSFQTLRSEGGLFIDMFNFLAFGKECVSWNFEKTGNPVYLHIKQTKKIVPEDRPSKKPTLLAIGVDGGFDNNDTEYEETRSIVILPDYISLPFPSVELPEKVRLAADAILLAEGAERKEQVAAWTAADSKQVSAYAVNLHQIDNGVVIPPSGWKCSQCDKTENLWLNLTDGVILCGRRNWDGSGGNNHAVEYYKKTGYPLAVKLGTITADIESADVYSYPEDDSVLDPLLAEHLAF
• ORF Type: 3prime_partial

Annotations of Ll_transcript_58017

• Blastp: Ubiquitin carboxyl-terminal hydrolase 14 from Arabidopsis with 80.08% of identity
• Blastx: Ubiquitin carboxyl-terminal hydrolase 14 from Arabidopsis with 80.08% of identity
• Eggnog: ubiquitin carboxyl-terminal hydrolase(COG5207)
• Kegg: Link to kegg annotations (AT3G20630)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019442658.1)
• Pfam: Zn-finger in ubiquitin-hydrolases and other protein (PF02148.18)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;