Protein coding transcript 238626

• Transcript: Ll_transcript_58019
• CDS coordinates: 3-617 (+)
• Peptide sequence: FGPGYTGLVNLGNSCYLAATMQVVFSTGSFSSRYYINQNLKKAFEAAPADPTVDLNMQLTKLAHGLLSGKYSTPASQNDENASVASSTLTDKQEGIPPRMFKAVIAASHPEFSSMRQQDALEFFLHFIDQVERANSGKTELDPSRSFKFGIEDRILCSSGKVAYNRRNDYILSLNIPLHEATNKEELESFHKLKAEKLSEGKEV*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_58019

• Blastp: Ubiquitin carboxyl-terminal hydrolase 14 from Arabidopsis with 74.62% of identity
• Blastx: Ubiquitin carboxyl-terminal hydrolase 14 from Arabidopsis with 74.62% of identity
• Eggnog: ubiquitin carboxyl-terminal hydrolase(COG5207)
• Kegg: Link to kegg annotations (AT3G20630)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019442658.1)
• Pfam: Ubiquitin carboxyl-terminal hydrolase (PF00443.28)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;