Protein coding transcript 238657

• Transcript: Ll_transcript_57970
• CDS coordinates: 1-507 (+)
• Peptide sequence: ASVLSGITNVVKELKDANLTVFTRTLRNEYTSLAFDYWSDPIFEIATYIQTARVDGLVTDFPATASRYLRSPCSDPKHVPTITPAQPGELLSTIPAELLPPAGAPLPPLEVADVVDPPLPAVVNMTKDAQAAAPTAPVAPSSVASANAYNVALSLVAILVFAMLSARH*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_57970

• Blastp: Glycerophosphodiester phosphodiesterase GDPDL7 from Arabidopsis with 50.3% of identity
• Blastx: Glycerophosphodiester phosphodiesterase GDPDL6 from Arabidopsis with 55.91% of identity
• Eggnog: glycerophosphoryl diester phosphodiesterase(COG0584)
• Kegg: Link to kegg annotations (AT5G58170)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019464595.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;