Protein coding transcript 238659

• Transcript: Ll_transcript_57973
• CDS coordinates: 2-376 (+)
• Peptide sequence: VPELQAKSGIFSFDITWTEIQTLKPQIVNTLSDVLRNPAEKNSGKFVTLPEFLELAKAKAVAGILVNISNAAYLASKKGLDIVGVVSTALSNATFDKQSTQQVLIQSDDSSVLSKFKDIPSYKRV
• ORF Type: internal

Annotations of Ll_transcript_57973

• Blastp: Glycerophosphodiester phosphodiesterase GDPDL6 from Arabidopsis with 67.72% of identity
• Blastx: Glycerophosphodiester phosphodiesterase GDPDL6 from Arabidopsis with 67.72% of identity
• Eggnog: glycerophosphoryl diester phosphodiesterase(COG0584)
• Kegg: Link to kegg annotations (AT5G58050)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019464595.1)
• Pfam: Glycerophosphoryl diester phosphodiesterase family (PF03009.16)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;