Protein coding transcript 238672

• Transcript: Ll_transcript_57995
• CDS coordinates: 837-1385 (+)
• Peptide sequence: MRSYSQDVAHNPDIKDLQLLNAFKDLIAESWDELPESVVYDVKEALSKNTDDKTGKDVVTNVFRAALAVEEFSGIITSLRMAIDDSVGMSGEDVKPLPDHMKNAIRTIFDRYGTYLSSFGPDETYLRKKVETELGTKLIHLKMRCSGLGAEWGKVSYIFTYQYLSSSTTQFSKIVSDCVWCQ*
• ORF Type: complete

Annotations of Ll_transcript_57995

• Blastp: Succinate dehydrogenase subunit 5, mitochondrial from Arabidopsis with 63.12% of identity
• Blastx: Succinate dehydrogenase subunit 5, mitochondrial from Arabidopsis with 61.9% of identity
• Eggnog: NA(ENOG4111Y8T)
• Kegg: Link to kegg annotations (AT1G47420)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019443140.1)
• Pfam: Domain of unknown function (DUF4370) (PF14290.5)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;