Protein coding transcript 238698

• Transcript: Ll_transcript_56069
• CDS coordinates: 1-399 (+)
• Peptide sequence: SHSPKFIICIQMAWILIIASLISLWILSLFKLLLFSHFPFSKHFNHKGRALQKRNVLLVIAHPDDESMFFTPTINFLTSRGHSVQILCLSVGDADGKGNIRKQELFQACVALKVPMQQVKIFNHPDLQVFIL*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_56069

• Blastp: N-acetylglucosaminyl-phosphatidylinositol de-N-acetylase from Homo with 35.9% of identity
• Blastx: Probable N-acetylglucosaminyl-phosphatidylinositol de-N-acetylase from Dictyostelium with 34.5% of identity
• Eggnog: lmbE family(COG2120)
• Kegg: Link to kegg annotations (9487)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019447785.1)
• Pfam: GlcNAc-PI de-N-acetylase (PF02585.16)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;