Protein coding transcript 238751

• Transcript: Ll_transcript_58459
• CDS coordinates: 3-743 (+)
• Peptide sequence: VFTQTKKDADEVSLSLTNIISSEALHGDISQHQRERTLNGFRQGKFTVLVATDVASRGLDIPNVDLVIHYELPNDPETFVHRSGRTGRAGKLGTAILMYTSSQRRTVRSLERDVGCKFEFISPPAIGEILESSADQVVATLKLVHPESIEFFTPTAEKLFEEQGTSALAAALAQLSGFSRPPSSRSLINHEQGWVTLQLTRDGDNSRRFLSASSVTGFLSVVYSPAADEVGKIHLIADEKIQGAVFD
• ORF Type: internal

Annotations of Ll_transcript_58459

• Blastp: DEAD-box ATP-dependent RNA helicase 3, chloroplastic from Oryza sativa with 80.57% of identity
• Blastx: DEAD-box ATP-dependent RNA helicase 3, chloroplastic from Arabidopsis with 82.19% of identity
• Eggnog: purine NTP-dependent helicase activity(COG0513)
• Kegg: Link to kegg annotations (4334649)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019452324.1)
• Pfam: Helicase conserved C-terminal domain (PF00271.30)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;