Protein coding transcript 238757

• Transcript: Ll_transcript_56700
• CDS coordinates: 2-946 (+)
• Peptide sequence: VGIEDCHSKRWPDSKWRSLKVRWDETSNIPRPDRVSPWKVEPALAPPALNPLPMPRPKKPRSNAIPPSPDSSVLTRQASSKVSEDPLPTNGFPRVLQGQEFSTLRGNFAESNKSDTAVRSVAWPPVEDKKIDVSTSRKYGSENWMSMGRHEPTYSDLLSGFGAGGDPSHPSLVYQTGHAAYPERMHSLNHEAKLRVHHPWSVMPCSLSLKLVDSNLKESANVDTAYQVRGNLSYSAYGQYPMFSHGHKVEHLHGNLMLPLPSTQYESSRSRELMSTPMSMKTSEAMTLKDGDCKLFGISLRSSHDAQEPSASQS*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_56700

• Blastp: Auxin response factor 2 from Arabidopsis with 47.56% of identity
• Blastx: Auxin response factor 2B from Lycopersicon with 50.48% of identity
• Eggnog: auxin response factor(ENOG4110RNJ)
• Kegg: Link to kegg annotations (AT5G62000)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019430108.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;