Protein coding transcript 238765

• Transcript: Ll_transcript_56710
• CDS coordinates: 3-917 (+)
• Peptide sequence: LSYAAFVETNRFPRVLQGQEICPLNSLTGKIDFKVGAWGNADVSCTTLNSHQATKHNFQSLGPQVLQSAYFPHGDINKDGRASMFFSKPTNLQRQDSPYNTTSTQTRIMRNEIEQSDLSNEHKLQHSISAAAPLAASNMRFPTEDNVKGKVNACKLFGFPLSGETTTTQNLQNSARSCTKVHKQGSLVGRAIDLSRLSCYNDLLSELEKLFGMEGLLRDPDKGWRILYTDDENDIMVVGDDPWHEFCNVVSKIHIYTQEEVDNMTIGMASDDTHSCLEQAPVIMEASKSSSVGQPDYSPTVVRV*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_56710

• Blastp: Auxin response factor 4 from Arabidopsis with 47.85% of identity
• Blastx: Auxin response factor 4 from Arabidopsis with 46.34% of identity
• Eggnog: auxin response factor(ENOG4111D9H)
• Kegg: Link to kegg annotations (AT5G60450)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019413610.1)
• Pfam: AUX/IAA family (PF02309.15)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;