Protein coding transcript 238821

• Transcript: Ll_transcript_57650
• CDS coordinates: 234-1103 (+)
• Peptide sequence: MGDQLAKAEEFEKKAEKKLTGWGLFGSKYEDAADLFDKSANSFKLAKSWDKAGSTYLKLANCHLKLESKHEASQAYVDAAHCYKKTNITESVSCLDHAVNLLCDIGRLSMAARYLKEIAELYESEQNIEQAVVYYEKSADFYENEEVTASANQCKQKVAQFAAQLEQYQKSIEIYEEIARQSLNNNLLKYGVKGHLLNAGICQLCKGDVIAITNALERYQELDPTFSGTREYRFLADIAAAIDEEDIGNFTDVVKEFDSMTPLDSWKTTLLLRVKEKLKVKELEEDDLT*
• ORF Type: complete

Annotations of Ll_transcript_57650

• Blastp: Alpha-soluble NSF attachment protein 2 from Arabidopsis with 75.43% of identity
• Blastx: Alpha-soluble NSF attachment protein from Vitis with 72.12% of identity
• Eggnog: attachment protein(ENOG410XPQ6)
• Kegg: Link to kegg annotations (AT3G56190)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019415244.1)
• Pfam: Soluble NSF attachment protein, SNAP (PF14938.5)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;