Protein coding transcript 238827

• Transcript: Ll_transcript_57684
• CDS coordinates: 234-899 (+)
• Peptide sequence: MGDQLAKAEEFEKKAEKKLTGWGLFGSKYEDAADLFDKSANSFKLAKSWDKAGSTYLKLANCHLKLESKHEASQAYVDAAHCYKKTNITESVSCLDHAVNLLCDIGRLSMAARYLKEIAELYESEQNIEQAVVYYEKSADFYENEEVTASANQCKQKVAQFAAQLEQYQKSIEIYEEIARQSLNNNLLKYGVKGHLLNAGICQLCKGDVIAITNALERYQV*
• ORF Type: complete

Annotations of Ll_transcript_57684

• Blastp: Alpha-soluble NSF attachment protein from Solanum with 71.17% of identity
• Blastx: Alpha-soluble NSF attachment protein from Vitis with 64.5% of identity
• Eggnog: -
• Kegg: Link to kegg annotations (102577508)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019415244.1)
• Pfam: Soluble NSF attachment protein, SNAP (PF14938.5)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;