Transcript | Ll_transcript_57655 |
---|---|
CDS coordinates | 844-1587 (+) |
Peptide sequence | MRHVLLGDKAGSTYLKLANCHLKLESKHEASQAYVDAAHSYKKTNINEAVSCLNNAVNLFCEIGRLSMAARYLKEIAELYESEQNIEQAVVYYEKAADFYENEEVSTSANQCKQKVAQFAAQLEQYQKSIEIYEDIARQSLNNNLLKYGVKGHLLNAGICQLCKGDVIAITNALERYQELDPTFSGTREYKLLADIAAAIDEEDVGNFTSVIKEFDSMSPLDSWKTTLLLRVKDKLKAKELEEDDLT* |
ORF Type | complete |
Blastp | Alpha-soluble NSF attachment protein from Vitis with 73.33% of identity |
---|---|
Blastx | Alpha-soluble NSF attachment protein from Vitis with 72.89% of identity |
Eggnog | attachment protein(ENOG410XPQ6) |
Kegg | Link to kegg annotations (100232837) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019456553.1) |
Pfam | Soluble NSF attachment protein, SNAP (PF14938.5) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer