Protein coding transcript 238861

• Transcript: Ll_transcript_56215
• CDS coordinates: 2-487 (+)
• Peptide sequence: VIVKNQDFIEATREGSLSFLAGKFDGILGLGFQEISVEDAVPLWYNLVEQNLVSKKVFSFWLNADPNAKKGGELVFGGVDSKHFKGEHTYAPVTRRGYWQIEMGDFLIGGLSTGVCGGGCAVIVDSGTSLLAGPTVCSSIFYGGNFLLIICFEVKEDHQQL*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_56215

• Blastp: Aspartic proteinase A2 from Arabidopsis with 64.71% of identity
• Blastx: Aspartic proteinase from Oryza sativa with 56.52% of identity
• Eggnog: aspartic(ENOG410XNV7)
• Kegg: Link to kegg annotations (AT1G62290)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019419261.1)
• Pfam: Eukaryotic aspartyl protease (PF00026.22)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;