Protein coding transcript 238863

• Transcript: Ll_transcript_56240
• CDS coordinates: 647-1018 (+)
• Peptide sequence: MVTEKETESKTRGDTPLCSSCQMLVIWIQNQLRQKNTKERVFSYVNQLCESLPSPAGESVISCDSLSRMPNITFTIGDKPFVLTPDQYILRTGEGIAEVCLSGFIALDVPAPRGPLWYVTFII*
• ORF Type: complete

Annotations of Ll_transcript_56240

• Blastp: Aspartic proteinase oryzasin-1 from Oryza sativa with 52.14% of identity
• Blastx: Aspartic proteinase from Oryza sativa with 55.56% of identity
• Eggnog: aspartic(ENOG410XNV7)
• Kegg: Link to kegg annotations (4339639)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019419261.1)
• Pfam: Saposin-like type B, region 1 (PF05184.14)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;