Transcript | Ll_transcript_56217 |
---|---|
CDS coordinates | 1-510 (+) |
Peptide sequence | NGTSCKISYGSGAISGFFSQDNIKVGDVVVKNQDFIEATREGSLSFLAGRFDGILGLGFQEISVEDAVPVWYNLVDQHLVTEKVFSFWLNGDPNAKKGGELVFGGVDTNHFKGEHTYVPVTRKGYWQIEMGDFLIGGLSTGVCEGGCAVIVDSGTSLLAGPTVCGSIFR* |
ORF Type | 5prime_partial |
Blastp | Cyprosin from Cynara with 70.55% of identity |
---|---|
Blastx | Cyprosin from Cynara with 70.55% of identity |
Eggnog | - |
Kegg | - |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019440635.1) |
Pfam | Eukaryotic aspartyl protease (PF00026.22) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer