Transcript | Ll_transcript_56218 |
---|---|
CDS coordinates | 647-1081 (+) |
Peptide sequence | MVTEKETESKTRGDTPLCSSCQMLVIWIQNQLRQKNTKERVFSYVNQLCESLPSPAGESVISCDSLSRMPNITFTIGDKPFVLTPDQYILRTGEGIAEVCLSGFIALDVPAPRGPLWILGDVFMRVYHTVFDYENAQVGFAIAA* |
ORF Type | complete |
Blastp | Aspartic proteinase oryzasin-1 from Oryza sativa with 55.56% of identity |
---|---|
Blastx | Aspartic proteinase from Oryza sativa with 56.52% of identity |
Eggnog | aspartic(ENOG410XNV7) |
Kegg | Link to kegg annotations (4339639) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019419261.1) |
Pfam | Saposin-like type B, region 1 (PF05184.14) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer