Protein coding transcript 238897

• Transcript: Ll_transcript_57745
• CDS coordinates: 162-734 (+)
• Peptide sequence: MLHVICIYWWYQNDDLLYPLVMIPPNATPFWHSIFIILVNDTLVRQAAMALKCFLLIYYKTGRGHNFRRQAQMLTLVEYTLLLYRALLPTPVWYRFFLNKDYGSLFSSLTTGLYLTFKLTSFVEKVKCFFSAVKALSRKDVNYGVCATMEQVNAAGDLCAICQEKMHAPILLRCKHIFCEECVSEWEIREK
• ORF Type: 3prime_partial

Annotations of Ll_transcript_57745

• Blastp: RING finger and transmembrane domain-containing protein 2 from Pongo with 28.57% of identity
• Blastx: RING finger and transmembrane domain-containing protein 2 from Pongo with 28.57% of identity
• Eggnog: Ring finger protein, transmembrane(ENOG4111HH8)
• Kegg: Link to kegg annotations (100174460)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019431458.1)
• Pfam: RING-type zinc-finger (PF13445.5)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;