Protein coding transcript 2389

• Transcript: Ll_transcript_428105
• CDS coordinates: 98-442 (+)
• Peptide sequence: MHKNRLQEFTQKYGLQLPEYRIVNEGFCHAPKFRSMVLVNGKEFKSRLTYRHRKDAEKDVAELALKTITEDIKNEECTTLPDLVYSKSILIEYAVKKNIENPQYKTTREGVLHHG
• ORF Type: 3prime_partial

Annotations of Ll_transcript_428105

• Blastp: Double-stranded RNA-binding protein 4 from Oryza sativa with 39.82% of identity
• Blastx: Double-stranded RNA-binding protein 4 from Oryza sativa with 39.82% of identity
• Eggnog: double-stranded RNA-binding protein 4-like(ENOG410YKXP)
• Kegg: Link to kegg annotations (4345448)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_020998813.1)
• Pfam: Double-stranded RNA binding motif (PF00035.25)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;