Protein coding transcript 23899

• Transcript: Ll_transcript_365294
• CDS coordinates: 281-613 (+)
• Peptide sequence: MAVAAATIVVPLSLLFFASGLVVNLIQTVCYVLVRPLSKNLYRRINRTVAELLWLELVWIIDWWAAVKVQVFTDRETLRLMGREHALVICNHRSDIDWLVGWVLAQRSGCL
• ORF Type: 3prime_partial

Annotations of Ll_transcript_365294

• Blastp: 1-acyl-sn-glycerol-3-phosphate acyltransferase 2 from Brassica with 77.48% of identity
• Blastx: 1-acyl-sn-glycerol-3-phosphate acyltransferase 2 from Brassica with 77.14% of identity
• Eggnog: -
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019444098.1)
• Pfam: Acyltransferase (PF01553.20)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;