Transcript | Ll_transcript_428106 |
---|---|
CDS coordinates | 48-452 (+) |
Peptide sequence | MASKQLFDLNKIDKAIPEESMHKNRLQEFTQKYGLQLPEYRIVNEGFCHAPKFRSMVLVNGKEFKSRLTYRHRKDAEKDVAELALKTITEDIKNEECTTLPDLVYSKSILIEYAVKKNIENPQYKTTREGVLHHG |
ORF Type | 3prime_partial |
Blastp | Double-stranded RNA-binding protein 4 from Oryza sativa with 39.82% of identity |
---|---|
Blastx | Double-stranded RNA-binding protein 4 from Oryza sativa with 39.82% of identity |
Eggnog | double-stranded RNA-binding protein 4-like(ENOG410YKXP) |
Kegg | Link to kegg annotations (4345448) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_020998813.1) |
Pfam | Double-stranded RNA binding motif (PF00035.25) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer