Transcript | Ll_transcript_58728 |
---|---|
CDS coordinates | 353-1204 (+) |
Peptide sequence | MGIDEVSGLNKHNPETWHVQVFRSIDSNSVKGFPKEPKDAIQRNLVCGKNVVIDMSIHSAYVKAIRAAQKFIYIENQYFLGSSFNWDSHKDLGANNLIPMEIALKIANKIKHHERFSVYVVIPMWPEGVPTSVSTQRILFWQFKTMQMMYETIYKALQEAGLDNVYEPQDYLNFFCLGNREISDNNENISNAAKRNGQNTPQVLAQKNRRFMIYVHSKGMIVDDEYVILGSANINQRSMEGTRDTEIAMGAYQPKHTWASKRSKPHGQARFINIEVVLLFKGF* |
ORF Type | complete |
Blastp | Phospholipase D beta 1 from Arabidopsis with 72.76% of identity |
---|---|
Blastx | Phospholipase D beta 1 from Arabidopsis with 73.11% of identity |
Eggnog | Catalyzes the reversible phosphatidyl group transfer from one phosphatidylglycerol molecule to another to form cardiolipin (CL) (diphosphatidylglycerol) and glycerol (By similarity)(COG1502) |
Kegg | Link to kegg annotations (AT2G42010) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019421976.1) |
Pfam | PLD-like domain (PF13091.5) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer