Protein coding transcript 239002

• Transcript: Ll_transcript_58731
• CDS coordinates: 353-1450 (+)
• Peptide sequence: MGIDEVSGLNKHNPETWHVQVFRSIDSNSVKGFPKEPKDAIQRNLVCGKNVVIDMSIHSAYVKAIRAAQKFIYIENQYFLGSSFNWDSHKDLGANNLIPMEIALKIANKIKHHERFSVYVVIPMWPEGVPTSVSTQRILFWQFKTMQMMYETIYKALQEAGLDNVYEPQDYLNFFCLGNREISDNNENISNAAKRNGQNTPQVLAQKNRRFMIYVHSKGMIVDDEYVILGSANINQRSMEGTRDTEIAMGAYQPKHTWASKRSKPHGQVHGYRMSLWSEHIGGYEKCFEEAESLECVRRIKSLGELNWKQYAAEEVTEMKSHLLKYPLEVDSKGKVKPLPGSETFPDVGGNIKGTFLVVQENLTI*
• ORF Type: complete

Annotations of Ll_transcript_58731

• Blastp: Phospholipase D beta 1 from Arabidopsis with 71.23% of identity
• Blastx: Phospholipase D beta 1 from Arabidopsis with 71.73% of identity
• Eggnog: Catalyzes the reversible phosphatidyl group transfer from one phosphatidylglycerol molecule to another to form cardiolipin (CL) (diphosphatidylglycerol) and glycerol (By similarity)(COG1502)
• Kegg: Link to kegg annotations (AT2G42010)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019421976.1)
• Pfam: PLD-like domain (PF13091.5)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;