Protein coding transcript 2391

• Transcript: Ll_transcript_428102
• CDS coordinates: 3-383 (+)
• Peptide sequence: RHNTKMASNSITITKILTFFSYFMLLTLMHLSNTVFSFTSHSSDTCNGSIAACNQENELVMESEISRRFMEEQRRYISNGALKRDKPVCNGGGSGEAYSKTGGCLPPPSNPQSRGCFKYYRCRGDS*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_428102

• Blastp: Protein RALF-like 32 from Arabidopsis with 46.49% of identity
• Blastx: Protein RALF-like 32 from Arabidopsis with 46.49% of identity
• Eggnog: Rapid ALkalinization Factor (RALF)(ENOG41119R7)
• Kegg: Link to kegg annotations (AT4G14010)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019442388.1)
• Pfam: Rapid ALkalinization Factor (RALF) (PF05498.10)
• Rfam: tRNA (RF00005)
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;