Protein coding transcript 239155

• Transcript: Ll_transcript_56749
• CDS coordinates: 1345-2211 (+)
• Peptide sequence: MVNANPSSSVQSPFFAASPFPVPPSQVSALKHSRTPSNALGMMDYQNSDHEQQLMKRLRSAQSIDDVAYSAPTQQASSSLDDLPRTVVCTLQQGSAVISMDFHPSFHSLLAVGCRNGEVSLWEAGLRKRLTSKPFEILNISACSTLFQALTVKDLSMSVNRVSWSPDGNFIGVAFTKHLIHLYAYQALNDLQLHLEIDAHVGGVNDLAFSHLNKQLCIVTCGDDKLVKVWDLTGRKLFNFEGHEAPVYSVCPHQKDKTQFIFSTAFDGKIKAWLYDNMGSRVDYDAPGQ
• ORF Type: 3prime_partial

Annotations of Ll_transcript_56749

• Blastp: Topless-related protein 2 from Arabidopsis with 70.24% of identity
• Blastx: Protein TPR1 from Oryza sativa with 59.35% of identity
• Eggnog: CTLH(ENOG410YEX8)
• Kegg: Link to kegg annotations (AT3G16830)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_020234411.1)
• Pfam: WD domain, G-beta repeat (PF00400.31)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;