Transcript | Ll_transcript_56549 |
---|---|
CDS coordinates | 319-621 (+) |
Peptide sequence | MAYPGSMQLSRTSGFCNSHHNPMGVGRLHLVTVNLSPLSLNKQKQDSSALHLLSRVPPIRHVPSKCKIFVCRSVLIPGGGSVTPLLKSSAVILTRLASLP* |
ORF Type | complete |
Blastp | Mechanosensitive ion channel protein 3, chloroplastic from Arabidopsis with 40% of identity |
---|---|
Blastx | Mechanosensitive ion channel protein 3, chloroplastic from Arabidopsis with 78.26% of identity |
Eggnog | Mechanosensitive ion channel(COG0668) |
Kegg | Link to kegg annotations (AT1G58200) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019417306.1) |
Pfam | - |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer