Transcript | Ll_transcript_58773 |
---|---|
CDS coordinates | 822-1247 (+) |
Peptide sequence | MATRTMDMDWKMRAIRVLPMFLLPALTFAAYSTSVSFTRMCDRRDQKILERLRAERQAKIDELKEKTNYYITQQLIQRYDPDPAAKAAAATVLASKLGADSGLKVYVGDDSNLGASMATSSDVELMQSTGLRNRRQVQSRST |
ORF Type | 3prime_partial |
Blastp | Uncharacterized protein At2g24330 from Arabidopsis with 65.49% of identity |
---|---|
Blastx | Uncharacterized protein At2g24330 from Arabidopsis with 66.45% of identity |
Eggnog | kiaa1715(ENOG4111I2R) |
Kegg | Link to kegg annotations (AT2G24330) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019417785.1) |
Pfam | - |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer