Protein coding transcript 239202

• Transcript: Ll_transcript_58757
• CDS coordinates: 173-727 (+)
• Peptide sequence: MVDDKAVGEGEEKETSVKATGNEKKKRKGFFSRIWNVFRLQGDDFEKRLQHISKEEAAVISRMSRRSRSWRRISRQLIIFSAIFEVIAVGYAIMATRTMDMDWKMRAIRVLPMFLLPALAFAAYSTSVSLIRMCKCLELYKNIHILQKLVYIFTYFLSIKVQVLPNWIVYILEKLVYISNVSIV*
• ORF Type: complete

Annotations of Ll_transcript_58757

• Blastp: Uncharacterized protein At2g24330 from Arabidopsis with 54.09% of identity
• Blastx: Uncharacterized protein At2g24330 from Arabidopsis with 52.87% of identity
• Eggnog: kiaa1715(ENOG4111I2R)
• Kegg: Link to kegg annotations (AT2G24330)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019437684.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;