Protein coding transcript 239203

• Transcript: Ll_transcript_58758
• CDS coordinates: 137-841 (+)
• Peptide sequence: MVDDKAIGEGEKKETSPTTTVNEKKKRKGFFSRIWNVFRLQGDDFEKRLQYISKEEAAVLSRMSRRSRSWRRISRQLTIFSVTFEVIAVGYAIMATRTMDMDWKMRAIRVLPMFLLPALTFAAYSTSVSFTRMCDRRDQKILERLRAERQAKIDELKEKTNYYITQQLIQRYDPDPAAKAAAATVLASKLGADSGLKVYVGDDSNLGASMATSSDVELMQSTGLRNRRQVQSRST
• ORF Type: 3prime_partial

Annotations of Ll_transcript_58758

• Blastp: Uncharacterized protein At2g24330 from Arabidopsis with 63.04% of identity
• Blastx: Uncharacterized protein At2g24330 from Arabidopsis with 63.04% of identity
• Eggnog: kiaa1715(ENOG4111I2R)
• Kegg: Link to kegg annotations (AT2G24330)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019417785.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;