Protein coding transcript 239206

• Transcript: Ll_transcript_58766
• CDS coordinates: 874-1299 (+)
• Peptide sequence: MATRTMDMDWKMRAIRVLPMFLLPALTFAAYSTSVSFTRMCDRRDQKILERLRAERQAKIDELKEKTNYYITQQLIQRYDPDPAAKAAAATVLASKLGADSGLKVYVGDDSNLGASMATSSDVELMQSTGLRNRRQVQSRST
• ORF Type: 3prime_partial

Annotations of Ll_transcript_58766

• Blastp: Uncharacterized protein At2g24330 from Arabidopsis with 65.49% of identity
• Blastx: Uncharacterized protein At2g24330 from Arabidopsis with 66.45% of identity
• Eggnog: kiaa1715(ENOG4111I2R)
• Kegg: Link to kegg annotations (AT2G24330)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019417785.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;