Protein coding transcript 239217

• Transcript: Ll_transcript_56523
• CDS coordinates: 1-321 (+)
• Peptide sequence: LAKSLEDEDGLVRQIDRNIEIVKEATKVMAEIKKGEQNLKKLRRDAANARETPHERKCLLQTIKSLDDLIDKSRSISVWEKVLIMCSYILIFLLPKSLLFCNDLNV*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_56523

• Blastp: Protein TONSOKU from Arabidopsis with 46.99% of identity
• Blastx: Protein TONSOKU from Arabidopsis with 46.99% of identity
• Eggnog: repeat-containing protein(COG0457)
• Kegg: Link to kegg annotations (AT3G18730)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019462892.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;