Protein coding transcript 239272

• Transcript: Ll_transcript_57254
• CDS coordinates: 2-538 (+)
• Peptide sequence: TSFLPPPLKPTTTTTPTTTKPIIPKIHSSLHRDPWSPIDGDITKPKPRTKDPSNPLSDDNARRIINGKARYLSVLRRNQGPQAETPRWIKRSPEQMVQYLEDDRNGQLYGKHVVAAIKKVRALSQRVDGEYEMRMVMATFVGKLSFREMCVVLKEQKGWRQVRDFFAWMKLQVWFGLS*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_57254

• Blastp: Pentatricopeptide repeat-containing protein At5g27270 from Arabidopsis with 74.13% of identity
• Blastx: Pentatricopeptide repeat-containing protein At5g27270 from Arabidopsis with 74.13% of identity
• Eggnog: Pentatricopeptide repeat-containing protein(ENOG410Z7Z7)
• Kegg: Link to kegg annotations (AT5G27270)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019432635.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;