Protein coding transcript 239304

• Transcript: Ll_transcript_56762
• CDS coordinates: 222-530 (+)
• Peptide sequence: MGANSLPSEASHDLDEQISQLMQCKPLSEQQVKVLCEKAKEILTDESNVQPVKSPVTICGDIHGQFHDLAELFRIGGKVSFLTMTFFLYSILLFQMGNFLTN*
• ORF Type: complete

Annotations of Ll_transcript_56762

• Blastp: Serine/threonine-protein phosphatase PP2A-4 catalytic subunit from Arabidopsis with 91.03% of identity
• Blastx: Serine/threonine-protein phosphatase PP2A-4 catalytic subunit from Arabidopsis with 91.03% of identity
• Eggnog: serine threonine-protein phosphatase(COG0639)
• Kegg: Link to kegg annotations (AT3G58500)
• CantataDB: Link to cantataDB annotations (CNT0001170)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_020215515.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;