Transcript | Ll_transcript_57850 |
---|---|
CDS coordinates | 50-412 (+) |
Peptide sequence | MVQRLTYRKRHSYATKSNQHRVVKTPGGKLVYQTTKKRASGPKCPVTGKRIQGIPHLRPAEYKRSRLSRNRRTVNRAYGGVLSGGAVRERIIRAFLVEEQKIVKKVLKIQKAKEKQASKA* |
ORF Type | complete |
Blastp | 60S ribosomal protein L34 from Pisum with 96.64% of identity |
---|---|
Blastx | 60S ribosomal protein L34 from Pisum with 97.89% of identity |
Eggnog | - |
Kegg | - |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019428122.1) |
Pfam | Ribosomal protein L34e (PF01199.17) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer