Transcript | Ll_transcript_56268 |
---|---|
CDS coordinates | 1-432 (+) |
Peptide sequence | AHGDICGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLARKVSLPRAILYIVAQCLGAISGVGLVKAFNKSLYTRYGGGANSLNDGYSTGTGLGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLSQSFTVLFY* |
ORF Type | 5prime_partial |
Blastp | Aquaporin PIP2-1 from Arabidopsis with 90.77% of identity |
---|---|
Blastx | Aquaporin PIP2-1 from Arabidopsis with 90.77% of identity |
Eggnog | Channel that permits osmotically driven movement of water in both directions. It is involved in the osmoregulation and in the maintenance of cell turgor during volume expansion in rapidly growing cells. It mediates rapid entry or exit of water in response to abrupt changes in osmolarity (By similarity)(COG0580) |
Kegg | Link to kegg annotations (AT3G53420) |
CantataDB | Link to cantataDB annotations (CNT0000345) |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019441933.1) |
Pfam | Major intrinsic protein (PF00230.19) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer