Protein coding transcript 2394

• Transcript: Ll_transcript_428044
• CDS coordinates: 1-537 (+)
• Peptide sequence: AGQIAGLNVLRVVNEPTAAALAYGLDKATDAVVAVYDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFAQEFKRKYKKDLTQNKRALRRLRTACERAKRTLSSSTQANIEIDSLYEGVDFYTSITRARFEELNADLFRSTMEPVEKSLRDAKMDKAQIHDIVLVGGST
• ORF Type: internal

Annotations of Ll_transcript_428044

• Blastp: Heat shock 70 kDa protein cognate 4 from Manduca with 88.4% of identity
• Blastx: Heat shock 70 kDa protein cognate 4 from Manduca with 88.4% of identity
• Eggnog: -
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_020977915.1)
• Pfam: Hsp70 protein (PF00012.19)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;