Protein coding transcript 239455

• Transcript: Ll_transcript_56338
• CDS coordinates: 668-1375 (+)
• Peptide sequence: MESNWDPFGLWIRICFGLVSLLGIQQCWSLNDEGLSLLEFRIRITADPYGSLANWNPNDSDPCKWSGVHCVDGKVQMLDLNGLSLEGTLAPELGKLSHLRSLVVCKNKFSGTIPKEIGDLGKLELLDLRENNLRGSIPAEIGRMLPLKRLLVCDNKIEDIDSEELEKLRLPSKLLFFDNCSPTFFGCMNRKFGHCMWHRDHSGQWNKADSLFIPIKGALIKYLNVLALPLCVDNL*
• ORF Type: complete

Annotations of Ll_transcript_56338

• Blastp: Protein MALE DISCOVERER 2 from Arabidopsis with 46.73% of identity
• Blastx: Protein MALE DISCOVERER 2 from Arabidopsis with 46.73% of identity
• Eggnog: LRR receptor-like serine threonine-protein kinase(ENOG410ZQU1)
• Kegg: Link to kegg annotations (AT4G18640)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019464446.1)
• Pfam: Leucine rich repeat N-terminal domain (PF08263.11)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;