Protein coding transcript 239457

• Transcript: Ll_transcript_56346
• CDS coordinates: 780-1574 (+)
• Peptide sequence: MECNWDPFGLWIKICVGLVSLWEIQQCWSLNDEGLALLEFRVRITFDPLGDLANWNLNDSDPCKWLGVHCVAGKVQMLDLNGLSLEGMLAPELGKLSHLKSLVLCKNKFSGTIPKELGDLGKLELLDLRENNLSGSIPLEIVRMLSLKRLLVCGNKIEAIDSEELQRLKLPSKWLFFDDCLSTFFVCKNRKFGHCVWHRDRFKQWNTADSLIIPIKEALVKYLHVLALPLFKLRNASLHNYEKNYRSDLPCKWRTLIKLCPVRN*
• ORF Type: complete

Annotations of Ll_transcript_56346

• Blastp: Protein MALE DISCOVERER 2 from Arabidopsis with 49.28% of identity
• Blastx: Protein MALE DISCOVERER 2 from Arabidopsis with 52.84% of identity
• Eggnog: LRR receptor-like serine threonine-protein kinase(ENOG410ZQU1)
• Kegg: Link to kegg annotations (AT4G18640)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019461085.1)
• Pfam: Leucine rich repeat N-terminal domain (PF08263.11)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;