Transcript | Ll_transcript_56326 |
---|---|
CDS coordinates | 668-1375 (+) |
Peptide sequence | MESNWDPFGLWIRICFGLVSLLGIQQCWSLNDEGLSLLEFRIRITADPYGSLANWNPNDSDPCKWSGVHCVDGKVQMLDLNGLSLEGTLAPELGKLSHLRSLVVCKNKFSGTIPKEIGDLGKLELLDLRENNLRGSIPAEIGRMLPLKRLLVCDNKIEDIDSEELEKLRLPSKLLFFDNCSPTFFGCMNRKFGHCMWHRDHSGQWNKADSLFIPIKGALIKYLNVLALPLCVDNL* |
ORF Type | complete |
Blastp | Protein MALE DISCOVERER 2 from Arabidopsis with 46.73% of identity |
---|---|
Blastx | Protein MALE DISCOVERER 2 from Arabidopsis with 46.73% of identity |
Eggnog | LRR receptor-like serine threonine-protein kinase(ENOG410ZQU1) |
Kegg | Link to kegg annotations (AT4G18640) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019464446.1) |
Pfam | Leucine rich repeat N-terminal domain (PF08263.11) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer