Protein coding transcript 23948

• Transcript: Ll_transcript_365344
• CDS coordinates: 530-868 (+)
• Peptide sequence: MQLDDSLLKKIETSSGQELKESRDLIRRIRRRDIYQFCNEFSVPKDRLEHFKDITSQDIVCSQLDGTSLKEDDVAVSIVKIDLTHGSKNPVERCLKEMMITIKAVYLFFYIC*
• ORF Type: complete

Annotations of Ll_transcript_365344

• Blastp: Deoxynucleoside triphosphate triphosphohydrolase SAMHD1 homolog from Dictyostelium with 35.87% of identity
• Blastx: Deoxynucleoside triphosphate triphosphohydrolase SAMHD1 homolog from Dictyostelium with 33.96% of identity
• Eggnog: Metal Dependent Phosphohydrolase(COG1078)
• Kegg: Link to kegg annotations (DDB_G0272484)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019439192.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;