Protein coding transcript 239486

• Transcript: Ll_transcript_56670
• CDS coordinates: 19-339 (-)
• Peptide sequence: MPDLVTGEGRDDDRDDDRDDDQESQGAPQSSLPLSVSVSKKGGPFLEFNCVAYADEIVIDSLSVKNPELSEDQIAYKGPDFQELDENLQKSFHKEDEKYSTNRACG*
• ORF Type: complete

Annotations of Ll_transcript_56670

• Blastp: Uncharacterized protein At2g39795, mitochondrial from Arabidopsis with 52.08% of identity
• Blastx: Uncharacterized protein At2g39795, mitochondrial from Arabidopsis with 49.37% of identity
• Eggnog: Mitochondrial glycoprotein family protein(ENOG4111MS5)
• Kegg: Link to kegg annotations (AT2G39795)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019457042.1)
• Pfam: Mitochondrial glycoprotein (PF02330.15)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;