| Transcript | Ll_transcript_56686 |
|---|---|
| CDS coordinates | 3273-3596 (+) |
| Peptide sequence | MDDFDDDQWGKWGKEEGDDDDKNEQVYDDVQLKLEMRDRVDNYFKFLHKLSTLKIKNVSLRDGSLAMDGNFGEDTYMRKELLYKLLTKVLHKYDLPRLEHHSSTVIF* |
| ORF Type | complete |
| Blastp | Sec1 family domain-containing protein MIP3 from Arabidopsis with 54.21% of identity |
|---|---|
| Blastx | Sec1 family domain-containing protein MIP3 from Arabidopsis with 55% of identity |
| Eggnog | NA(ENOG4111C06) |
| Kegg | Link to kegg annotations (AT2G42700) |
| CantataDB | - |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_019457042.1) |
| Pfam | - |
| Rfam | - |
| GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer