Protein coding transcript 23954

• Transcript: Ll_transcript_365357
• CDS coordinates: 453-947 (+)
• Peptide sequence: MKATPINTLNPQRTAMIVADFLKAGNVSSPADLRYGEDLLFPGRLIEDAGNVRVGRAVHKVIKPSRFVELQQMFPEEKFLLNRSDKCIDMVLQKDAVGEDALRGWLVAAYAAQTDKSSHELSASTLQEAYERMNDVFPVFLKELQNKGWHTDRFLDGTGSRFAL*
• ORF Type: complete

Annotations of Ll_transcript_365357

• Blastp: Protein root UVB sensitive 2, chloroplastic from Arabidopsis with 62.58% of identity
• Blastx: Protein root UVB sensitive 2, chloroplastic from Arabidopsis with 63.54% of identity
• Eggnog: Chromosome 16 open reading frame 58(ENOG410XU74)
• Kegg: Link to kegg annotations (AT2G31190)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019429195.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;