Transcript | Ll_transcript_58550 |
---|---|
CDS coordinates | 78-785 (+) |
Peptide sequence | MEPIFLFFIKLSPLFFLCSNAESKCTQGCPTALASYYMFNGSDLTYISQIMSSYLLHSPEDIVSYNKDTITNKDKVEAFTRVNVPFPCECIEGEFLGHRFQYVVQKGDTYETVAGTNYANLINVEWLMRFNTYPADSIPSTGILNVTVNCSCGNSDVSDYELFITYPLRPGETLGSVASSVKLDSGLLQRYNPSVNFNQGSGLVYIPGKDQNGSYVFLSSSSGGLIFSLLSILVM* |
ORF Type | complete |
Blastp | LysM domain receptor-like kinase 3 from Medicago with 49.33% of identity |
---|---|
Blastx | Chitin elicitor receptor kinase 1 from Oryza sativa with 83.56% of identity |
Eggnog | - |
Kegg | Link to kegg annotations (MTR_5g086130) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019455827.1) |
Pfam | LysM domain (PF01476.19) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer